Tesamorelin
CAS #: 218949-48-5

Tesamorelin
- Grade: Laboratory
- Purity: >99%
- Vial Size: 10mg
- Tested For: Purity, Sterility, & Endotoxins
- Arrives: Lyophilized: Requires Reconstitution Get bacteriostatic water
Certificate of Analysis
Third-party tested for 99% purity, ID, quantity.
Frequently asked questions
Research Use Only
This product is limited to in vitro testing and laboratory experimentation only and is not for human or animal use or consumption of any kind. Handling and use are restricted to qualified and licensed professionals only. Bacteriostatic water not included and sold separately. We are unable to provide guidance on dosages or reconstitution.
Tesamorelin Overview
Compound: Tesamorelin
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL (N-term 3-hexenoyl)
Molecular Formula: C221H366N72O67S
Molecular Weight: ~5,136 g/mol
Product Care & Storage
- For long-term stability, store at -20°C (freezer).
- Keep away from light, moisture, and heat.
- After reconstitution, refrigerate at 2–8°C.
- Do not use solution if it becomes discolored or shows signs of contamination.
Product Disclaimer
Supplied as lyophilized powder for research use only. Reconstitution of research compounds is the sole responsibility of the researcher. Bacteriostatic water is not included and is sold separately. We do not sell syringes or offer guidance on mixing, dosing, or research protocols.
For in vitro testing and laboratory use only. Not for human or animal use or consumption. Use is restricted to qualified and licensed professionals.
This product is not a drug, food, or cosmetic and must not be misbranded, misused, or mislabeled.

Tesamorelin Overview
Compound: Tesamorelin
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL (N-term 3-hexenoyl)
Molecular Formula: C221H366N72O67S
Molecular Weight: ~5,136 g/mol
Product Care & Storage
- For long-term stability, store at -20°C (freezer).
- Keep away from light, moisture, and heat.
- After reconstitution, refrigerate at 2–8°C.
- Do not use solution if it becomes discolored or shows signs of contamination.
Product Disclaimer
Supplied as lyophilized powder for research use only. Reconstitution of research compounds is the sole responsibility of the researcher. Bacteriostatic water is not included and is sold separately. We do not sell syringes or offer guidance on mixing, dosing, or research protocols.
For in vitro testing and laboratory use only. Not for human or animal use or consumption. Use is restricted to qualified and licensed professionals.
This product is not a drug, food, or cosmetic and must not be misbranded, misused, or mislabeled.
Tesamorelin
- Grade: Laboratory
- Purity: >99%
- Vial Size: 10mg
- Tested For: Purity, Sterility, & Endotoxins
- Arrives: Lyophilized: Requires Reconstitution Get bacteriostatic water
Certificate of Analysis
Third-party tested for 99% purity, ID, quantity.
Frequently asked questions
Research Use Only
This product is limited to in vitro testing and laboratory experimentation only and is not for human or animal use or consumption of any kind. Handling and use are restricted to qualified and licensed professionals only. Bacteriostatic water not included and sold separately. We are unable to provide guidance on dosages or reconstitution.